PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK15387.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family GRAS
Protein Properties Length: 746aa    MW: 84023.3 Da    PI: 5.4106
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK15387.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS362.18e-1113747432373
       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqa 101
                  lL++cA+avs++d ++a++lL+++++++sp gd +qRl + f+ AL+arl ++++e++++l +++ +    +  l+ ++++  + P+ k+s + aNq+
  PK15387.1 374 LALLISCAQAVSANDIRNANELLKKIRKHSSPFGDGTQRLGHLFADALEARLDGTGKEICDTLGATKLP---ADILLKTYHTYISANPYKKISIIFANQM 470
                579************************************************************999998...7889999********************* PP

       GRAS 102 IleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpg 199
                I +a+e+++++HiiDf+i +G QWp ++q+L+ Rp+gpp+lRiTg++ p++g   ++++eetg+ Lak++e++gvpfe+n  +ak++e++++++L+++++
  PK15387.1 471 IFKAAEKATKLHIIDFGILYGYQWPVFIQSLSRRPGGPPKLRITGIEFPQHGfrPEKMVEETGSVLAKYCERFGVPFEYNG-IAKQWENVQIDDLKIDRN 569
                ***************************************************9*9***************************.7***************** PP

       GRAS 200 EalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvva 299
                E+laVn+ ++  ++lde+++++s+rd+vL+l+++++P+++ ++  +  +n + F++rf e+l ++s+l+d  ++ l+re++ r + E+ +lgrei+nv+a
  PK15387.1 570 EVLAVNCLHRFRSILDETAAVRSPRDAVLNLIRKIKPNIFAHAVFNGAYNVPFFVTRFRETLFFFSSLLDGADTILAREDQLRLSFEKYILGREIMNVIA 669
                **************************************************************************************************** PP

       GRAS 300 cegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                ceg+er+er et+++W+ r+++aGF+++pl+ + +k +k+++++ + + + vee+s+++++gWk+r L + S+W
  PK15387.1 670 CEGSERVERPETYKQWQLRITRAGFRQLPLDMELVKRMKSIVKHGYHRDFVVEEDSNWMLQGWKGRILCASSCW 743
                ********************************************99999************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.599347724IPR005202Transcription factor GRAS
PfamPF035142.8E-108374743IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 746 aa     Download sequence    Send to blast
XIDLVTGKSV KLLICIDGNV AQLSNLSFIV SLDQYPDSIN DIRASEIIMD YSFDPSMSSE  60
RGSLVNDGEF SCTALDYINQ MLMDEDMEAK PSLFYDPSAL IATEKSFYEA LGEKYPPSEY  120
EHEQPQYRDQ NFQSSDDSFT TSVSDCSEDI SSSSCSSTGN STHSVGTSVD SVAHRPSAKF  180
ENQSTSDSSS QSSANSTYKI GTSLGELQNF LSENELMLQF KRGLEEGNKF LPKGNQLGFP  240
MENNKNMSPY TNEKVSNELV EVKKDKKREQ LHIRLTEKKK NHDREDTDLV DGRSNKQMAV  300
STDDTGLSEL FDKVLLFREE QEAPSGTSDE SYQNNEVDSS SRQQEGGSHG TTNSGKTASK  360
TKILNNDKEV VDLLALLISC AQAVSANDIR NANELLKKIR KHSSPFGDGT QRLGHLFADA  420
LEARLDGTGK EICDTLGATK LPADILLKTY HTYISANPYK KISIIFANQM IFKAAEKATK  480
LHIIDFGILY GYQWPVFIQS LSRRPGGPPK LRITGIEFPQ HGFRPEKMVE ETGSVLAKYC  540
ERFGVPFEYN GIAKQWENVQ IDDLKIDRNE VLAVNCLHRF RSILDETAAV RSPRDAVLNL  600
IRKIKPNIFA HAVFNGAYNV PFFVTRFRET LFFFSSLLDG ADTILAREDQ LRLSFEKYIL  660
GREIMNVIAC EGSERVERPE TYKQWQLRIT RAGFRQLPLD MELVKRMKSI VKHGYHRDFV  720
VEEDSNWMLQ GWKGRILCAS SCWVPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-453737434374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010106504.10.0hypothetical protein L484_025264
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLW9RUF90.0W9RUF9_9R
STRINGPOPTR_0009s03790.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14